Lineage for d1f5xa_ (1f5x A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719559Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 2719560Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. 2719561Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
    Pfam PF00621
  6. 2719612Protein RhoGEF Vav [48071] (1 species)
  7. 2719613Species Mouse (Mus musculus) [TaxId:10090] [48072] (1 PDB entry)
  8. 2719614Domain d1f5xa_: 1f5x A: [18516]
    autoinhibited

Details for d1f5xa_

PDB Entry: 1f5x (more details)

PDB Description: nmr structure of the y174 autoinhibited dbl homology domain
PDB Compounds: (A:) rho-gef vav

SCOPe Domain Sequences for d1f5xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5xa_ a.87.1.1 (A:) RhoGEF Vav {Mouse (Mus musculus) [TaxId: 10090]}
mkgdeiyedlmrlesvptppkmteydkrccclreiqqteekytdtlgsiqqhfmkplqrf
lkpqdmetifvnieelfsvhthflkelkdalagpgattlyqvfikykerflvygrycsqv
esaskhldqvataredvqmkleecsqranngrftlrdllmvpmqrvlkyhlllqelvkht
qdatekenlrlaldamrdlaqcvnevkr

SCOPe Domain Coordinates for d1f5xa_:

Click to download the PDB-style file with coordinates for d1f5xa_.
(The format of our PDB-style files is described here.)

Timeline for d1f5xa_: