SCOPe 2.08: Domain d1f5xa_: 1f5x A:

Lineage for d1f5xa_ (1f5x A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
   multihelical; core: 5-helical bundle

4. Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families)
   automatically mapped to Pfam PF00621

5. Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
   Pfam PF00621

6. Protein RhoGEF Vav [48071] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [48072] (1 PDB entry)

8. Domain d1f5xa_: 1f5x A: [18516]
   autoinhibited

Details for d1f5xa_

PDB Entry: 1f5x

PDB Description: nmr structure of the y174 autoinhibited dbl homology domain

PDB Compounds: (A:) rho-gef vav

SCOPe Domain Sequences for d1f5xa_:

Sequence; same for both SEQRES and ATOM records:

>d1f5xa_ a.87.1.1 (A:) RhoGEF Vav {Mouse (Mus musculus) [TaxId: 10090]}
mkgdeiyedlmrlesvptppkmteydkrccclreiqqteekytdtlgsiqqhfmkplqrf
lkpqdmetifvnieelfsvhthflkelkdalagpgattlyqvfikykerflvygrycsqv
esaskhldqvataredvqmkleecsqranngrftlrdllmvpmqrvlkyhlllqelvkht
qdatekenlrlaldamrdlaqcvnevkr

Timeline for d1f5xa_:

• d1f5xa_ first appeared (with stable ids) in SCOP 1.55
  
• d1f5xa_ appears in SCOPe 2.07