Lineage for d3rnza_ (3rnz A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1173024Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1173786Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) (S)
  5. 1173787Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (2 proteins)
  6. 1173788Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (4 species)
  7. 1173789Species Bacillus amyloliquefaciens [TaxId:1390] [53186] (3 PDB entries)
  8. 1173794Domain d3rnza_: 3rnz A: [185070]
    automated match to d1auga_

Details for d3rnza_

PDB Entry: 3rnz (more details), 2.01 Å

PDB Description: crystal structure of bacillus amyloliquefaciens pyroglutamyl peptidase i
PDB Compounds: (A:) Pyrrolidone-carboxylate peptidase

SCOPe Domain Sequences for d3rnza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rnza_ c.56.4.1 (A:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Bacillus amyloliquefaciens [TaxId: 1390]}
ekkvlltgfdpfggetvnpsweavkrlngaaegpasivseqvptvfykslavlreamkkh
qpdiiicvgqaggrmqitpervainlnearipdnegnqpvgedisqggpaaywtglpikr
iveeikkegipaavsytagtfvcnhlfyglmdeisrhhphirggfihipyipeqtlqksa
pslsldhitkalkiaavtaaaheddie

SCOPe Domain Coordinates for d3rnza_:

Click to download the PDB-style file with coordinates for d3rnza_.
(The format of our PDB-style files is described here.)

Timeline for d3rnza_: