SCOPe 2.06: Domain d3rnme1: 3rnm E:110-152

Lineage for d3rnme1 (3rnm E:110-152)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
   3 helices; bundle, closed, right-handed twist; up-and-down

4. Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families)

5. Family a.9.1.0: automated matches [191674] (1 protein)
   not a true family

6. Protein automated matches [191291] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189945] (2 PDB entries)

8. Domain d3rnme1: 3rnm E:110-152 [185064]
   Other proteins in same PDB: d3rnme2, d3rnmf2
   automated match to d1w3da_
   complexed with bme, fad, nhe

Details for d3rnme1

PDB Entry: 3rnm, 2.4 Å

PDB Description: The crystal structure of the subunit binding of human dihydrolipoamide transacylase (E2b) bound to human dihydrolipoamide dehydrogenase (E3)

PDB Compounds: (E:) Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial

SCOPe Domain Sequences for d3rnme1:

Sequence; same for both SEQRES and ATOM records:

>d3rnme1 a.9.1.0 (E:110-152) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tlatpavrnlamenniklsevvgsgkdgrilkedilnylekqt

Timeline for d3rnme1:

• d3rnme1 first appeared in SCOPe 2.01, called d3rnme_
  
• d3rnme1 was called d3rnme_ in SCOPe 2.05
  
• d3rnme1 appears in SCOPe 2.07
  
• d3rnme1 appears in the current release, SCOPe 2.08