Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
Protein automated matches [190239] (26 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189952] (2 PDB entries) |
Domain d3rmua1: 3rmu A:45-176 [185030] Other proteins in same PDB: d3rmua2, d3rmub2, d3rmuc2, d3rmud2 automated match to d1jc4a_ complexed with co, edo, pg4 |
PDB Entry: 3rmu (more details), 1.8 Å
SCOPe Domain Sequences for d3rmua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rmua1 d.32.1.0 (A:45-176) automated matches {Human (Homo sapiens) [TaxId: 9606]} lgrlnhvaiavpdlekaaafyknilgaqvseavplpehgvsvvfvnlgntkmellhplgl dspiagflqknkaggmhhicievdninaavmdlkkkkirslseevkigahgkpviflhpk dcggvlveleqa
Timeline for d3rmua1: