Class a: All alpha proteins [46456] (171 folds) |
Fold a.85: Hemocyanin, N-terminal domain [48049] (1 superfamily) 6 helices; bundle; one central helix is surrounded by 5 others |
Superfamily a.85.1: Hemocyanin, N-terminal domain [48050] (1 family) |
Family a.85.1.1: Hemocyanin, N-terminal domain [48051] (1 protein) |
Protein Hemocyanin, N-terminal domain [48052] (2 species) Middle domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich |
Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [48054] (7 PDB entries) |
Domain d1hc6_1: 1hc6 5-135 [18493] Other proteins in same PDB: d1hc6_2, d1hc6_3 complexed with cu |
PDB Entry: 1hc6 (more details), 3.2 Å
SCOP Domain Sequences for d1hc6_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hc6_1 a.85.1.1 (5-135) Hemocyanin, N-terminal domain {Spiny lobster (Panulirus interruptus)} tgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkelndhr lleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyalyvsvi hsklgdgivlp
Timeline for d1hc6_1: