![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.7: 14-3-3 protein [48445] (1 family) ![]() automatically mapped to Pfam PF00244 |
![]() | Family a.118.7.1: 14-3-3 protein [48446] (5 proteins) |
![]() | Protein zeta isoform [48449] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48451] (7 PDB entries) |
![]() | Domain d3rdhc_: 3rdh C: [184888] automated match to d1qjba_ complexed with 3rd, ni |
PDB Entry: 3rdh (more details), 2.39 Å
SCOPe Domain Sequences for d3rdhc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rdhc_ a.118.7.1 (C:) zeta isoform {Human (Homo sapiens) [TaxId: 9606]} gshmdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrs swrvvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvf ylkmkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvf yyeilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts
Timeline for d3rdhc_: