Lineage for d3rdhc_ (3rdh C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1278585Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1279239Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 1279240Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 1279257Protein zeta isoform [48449] (2 species)
  7. 1279267Species Human (Homo sapiens) [TaxId:9606] [48451] (7 PDB entries)
  8. 1279280Domain d3rdhc_: 3rdh C: [184888]
    automated match to d1qjba_
    complexed with 3rd, ni

Details for d3rdhc_

PDB Entry: 3rdh (more details), 2.39 Å

PDB Description: X-ray induced covalent inhibition of 14-3-3
PDB Compounds: (C:) 14-3-3 protein zeta/delta

SCOPe Domain Sequences for d3rdhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rdhc_ a.118.7.1 (C:) zeta isoform {Human (Homo sapiens) [TaxId: 9606]}
gshmdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrs
swrvvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvf
ylkmkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvf
yyeilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts

SCOPe Domain Coordinates for d3rdhc_:

Click to download the PDB-style file with coordinates for d3rdhc_.
(The format of our PDB-style files is described here.)

Timeline for d3rdhc_: