| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.7: 14-3-3 protein [48445] (1 family) ![]() automatically mapped to Pfam PF00244 |
| Family a.118.7.1: 14-3-3 protein [48446] (5 proteins) |
| Protein zeta isoform [48449] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [48451] (13 PDB entries) |
| Domain d3rdhc1: 3rdh C:1-230 [184888] Other proteins in same PDB: d3rdha2, d3rdhb2, d3rdhc2, d3rdhd2 automated match to d1qjba_ complexed with 3rd, ni |
PDB Entry: 3rdh (more details), 2.39 Å
SCOPe Domain Sequences for d3rdhc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rdhc1 a.118.7.1 (C:1-230) zeta isoform {Human (Homo sapiens) [TaxId: 9606]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts
Timeline for d3rdhc1: