Lineage for d3rdhc1 (3rdh C:1-230)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726458Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2726459Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2726478Protein zeta isoform [48449] (2 species)
  7. 2726488Species Human (Homo sapiens) [TaxId:9606] [48451] (13 PDB entries)
  8. 2726497Domain d3rdhc1: 3rdh C:1-230 [184888]
    Other proteins in same PDB: d3rdha2, d3rdhb2, d3rdhc2, d3rdhd2
    automated match to d1qjba_
    complexed with 3rd, ni

Details for d3rdhc1

PDB Entry: 3rdh (more details), 2.39 Å

PDB Description: X-ray induced covalent inhibition of 14-3-3
PDB Compounds: (C:) 14-3-3 protein zeta/delta

SCOPe Domain Sequences for d3rdhc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rdhc1 a.118.7.1 (C:1-230) zeta isoform {Human (Homo sapiens) [TaxId: 9606]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts

SCOPe Domain Coordinates for d3rdhc1:

Click to download the PDB-style file with coordinates for d3rdhc1.
(The format of our PDB-style files is described here.)

Timeline for d3rdhc1: