SCOPe 2.01: Domain d3ra0a_: 3ra0 A:

Lineage for d3ra0a_ (3ra0 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
   helix-swapped dimer of beta(4)-alpha motifs

4. Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families)

5. Family d.18.1.0: automated matches [191638] (1 protein)
   not a true family

6. Protein automated matches [191174] (1 species)
   not a true protein

7. Species Potato (Solanum tuberosum) [TaxId:4113] [189417] (7 PDB entries)

8. Domain d3ra0a_: 3ra0 A: [184870]
   automated match to d1l3aa_
   protein/DNA complex

Details for d3ra0a_

PDB Entry: 3ra0, 2.45 Å

PDB Description: Crystal Structure of a StWhy2 K67A-dT32 complex

PDB Compounds: (A:) Why2 protein

SCOPe Domain Sequences for d3ra0a_:

Sequence; same for both SEQRES and ATOM records:

>d3ra0a_ d.18.1.0 (A:) automated matches {Potato (Solanum tuberosum) [TaxId: 4113]}
grvfapysvfkgaaalsaeprlptfnrldsggvklnrrgvimltfwpsvgerkydwekrq
lfalsatevgslismgtrdsseffhdpsmlssnagqvrkslsikpnadgsgyfislsvvn
nnlktndrftvpvttaefavmrtafsfalphimgwdrftnr

Timeline for d3ra0a_:

• d3ra0a_ is new in SCOPe 2.01-stable
  
• d3ra0a_ appears in SCOPe 2.02
  
• d3ra0a_ appears in the current release, SCOPe 2.08