Lineage for d3r85c_ (3r85 C:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1236526Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1236566Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 1236567Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 1236661Protein automated matches [190236] (2 species)
    not a true protein
  7. 1236662Species Human (Homo sapiens) [TaxId:9606] [188722] (20 PDB entries)
  8. 1236673Domain d3r85c_: 3r85 C: [184842]
    automated match to d1g5ja_
    complexed with so4

Details for d3r85c_

PDB Entry: 3r85 (more details), 1.95 Å

PDB Description: crystal structure of human soul bh3 domain in complex with bcl-xl
PDB Compounds: (C:) Bcl-2-like protein 1

SCOPe Domain Sequences for d3r85c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r85c_ f.1.4.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitpgt
ayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylndhl
epwiqenggwdtfvelygn

SCOPe Domain Coordinates for d3r85c_:

Click to download the PDB-style file with coordinates for d3r85c_.
(The format of our PDB-style files is described here.)

Timeline for d3r85c_: