Lineage for d1cd31_ (1cd3 1:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772974Fold a.84: Scaffolding protein gpD of bacteriophage procapsid [48044] (1 superfamily)
    core: 6 helices; one central helix is surrounded by 5 others
  4. 772975Superfamily a.84.1: Scaffolding protein gpD of bacteriophage procapsid [48045] (1 family) (S)
  5. 772976Family a.84.1.1: Scaffolding protein gpD of bacteriophage procapsid [48046] (1 protein)
  6. 772977Protein Scaffolding protein gpD of bacteriophage procapsid [48047] (1 species)
  7. 772978Species Bacteriophage phi-X174 [TaxId:10847] [48048] (3 PDB entries)
  8. 772984Domain d1cd31_: 1cd3 1: [18481]
    Other proteins in same PDB: d1cd3f_, d1cd3g_

Details for d1cd31_

PDB Entry: 1cd3 (more details), 3.5 Å

PDB Description: procapsid of bacteriophage phix174
PDB Compounds: (1:) protein (scaffolding protein gpd)

SCOP Domain Sequences for d1cd31_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cd31_ a.84.1.1 (1:) Scaffolding protein gpD of bacteriophage procapsid {Bacteriophage phi-X174 [TaxId: 10847]}
eqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldf
vgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftl
rvragntdvltdaeenvrqklra

SCOP Domain Coordinates for d1cd31_:

Click to download the PDB-style file with coordinates for d1cd31_.
(The format of our PDB-style files is described here.)

Timeline for d1cd31_: