Lineage for d1cd31_ (1cd3 1:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5085Fold a.84: Scaffolding protein gpD of bacteriophage procapsid [48044] (1 superfamily)
  4. 5086Superfamily a.84.1: Scaffolding protein gpD of bacteriophage procapsid [48045] (1 family) (S)
  5. 5087Family a.84.1.1: Scaffolding protein gpD of bacteriophage procapsid [48046] (1 protein)
  6. 5088Protein Scaffolding protein gpD of bacteriophage procapsid [48047] (1 species)
  7. 5089Species Bacteriophage phi-X174 [TaxId:10847] [48048] (2 PDB entries)
  8. 5094Domain d1cd31_: 1cd3 1: [18481]
    Other proteins in same PDB: d1cd3f_, d1cd3g_

Details for d1cd31_

PDB Entry: 1cd3 (more details), 3.5 Å

PDB Description: procapsid of bacteriophage phix174

SCOP Domain Sequences for d1cd31_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cd31_ a.84.1.1 (1:) Scaffolding protein gpD of bacteriophage procapsid {Bacteriophage phi-X174}
eqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldf
vgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftl
rvragntdvltdaeenvrqklra

SCOP Domain Coordinates for d1cd31_:

Click to download the PDB-style file with coordinates for d1cd31_.
(The format of our PDB-style files is described here.)

Timeline for d1cd31_: