Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.2: UEV domain [75383] (3 proteins) |
Protein automated matches [191205] (2 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189944] (2 PDB entries) |
Domain d3r42a_: 3r42 A: [184796] automated match to d1uzxa_ |
PDB Entry: 3r42 (more details), 1.87 Å
SCOPe Domain Sequences for d3r42a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r42a_ d.20.1.2 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gkisvpeavvnwlfkviqpiyndgrttfhdslalldnfhslrprtrvfthsdgtpqllls iygtistgedgssphsipvimwvpsmypvkppfisinlenfdmntissslpiqeyidsng wialpilhawdpaamnlimvvqelmsllheppqdqa
Timeline for d3r42a_: