SCOPe 2.04: Domain d3qzra_: 3qzr A:

Lineage for d3qzra_ (3qzr A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (19 species)
   not a true protein

7. Species Human enterovirus 71 [TaxId:39054] [189708] (7 PDB entries)

8. Domain d3qzra_: 3qzr A: [184740]
   automated match to d1l1na_
   complexed with ag7, edo; mutant

Details for d3qzra_

PDB Entry: 3qzr, 1.04 Å

PDB Description: human enterovirus 71 3c protease mutant e71a in complex with rupintrivir

PDB Compounds: (A:) 3C protein

SCOPe Domain Sequences for d3qzra_:

Sequence; same for both SEQRES and ATOM records:

>d3qzra_ b.47.1.0 (A:) automated matches {Human enterovirus 71 [TaxId: 39054]}
gpsldfalsllrrnvrqvqtdqghftmlgvrdrlavlprhsqpgktiwiehklvnvldav
elvdeqgvnlaltlitldtnekfrditkfipenistasdatlvintehmpsmfvpvgdvv
qygflnlsgkpthrtmmynfptkagqcggvvtsvgkiigihiggngrqgfcaglkrsyfa

Timeline for d3qzra_:

• d3qzra_ first appeared in SCOPe 2.01
  
• d3qzra_ appears in SCOPe 2.03
  
• d3qzra_ appears in SCOPe 2.05
  
• d3qzra_ appears in the current release, SCOPe 2.08