SCOPe 2.04: Domain d3qzoa_: 3qzo A:

Lineage for d3qzoa_ (3qzo A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.28: NEAT domain-like [158911] (2 families)

5. Family b.1.28.1: NEAT domain [158912] (4 proteins)
   Pfam PF05031; iron transport-associated domain

6. Protein automated matches [191246] (3 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158879] [189734] (5 PDB entries)

8. Domain d3qzoa_: 3qzo A: [184730]
   automated match to d2o1aa1
   complexed with gol, hem

Details for d3qzoa_

PDB Entry: 3qzo, 1.95 Å

PDB Description: Staphylococcus aureus IsdA NEAT domain in complex with heme, reduced crystal

PDB Compounds: (A:) Iron-regulated surface determinant protein A

SCOPe Domain Sequences for d3qzoa_:

Sequence; same for both SEQRES and ATOM records:

>d3qzoa_ b.1.28.1 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
atsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeykfynann
qelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefekaiptl
a

Timeline for d3qzoa_:

• d3qzoa_ first appeared in SCOPe 2.01
  
• d3qzoa_ appears in SCOPe 2.03
  
• d3qzoa_ appears in SCOPe 2.05
  
• d3qzoa_ appears in the current release, SCOPe 2.08