Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein automated matches [190149] (7 species) not a true protein |
Species Staphylococcus aureus [TaxId:93061] [189958] (4 PDB entries) |
Domain d3qwdl_: 3qwd L: [184674] automated match to d1tyfa_ complexed with cl |
PDB Entry: 3qwd (more details), 2.1 Å
SCOPe Domain Sequences for d3qwdl_:
Sequence, based on SEQRES records: (download)
>d3qwdl_ c.14.1.1 (L:) automated matches {Staphylococcus aureus [TaxId: 93061]} liptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiyl yinspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmi hqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeake yglidevmvpe
>d3qwdl_ c.14.1.1 (L:) automated matches {Staphylococcus aureus [TaxId: 93061]} liptvieydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyinspggs vtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplggqa teieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvpe
Timeline for d3qwdl_: