Lineage for d3qwdl_ (3qwd L:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980706Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 980707Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 980708Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
  6. 980845Protein automated matches [190149] (5 species)
    not a true protein
  7. 980960Species Staphylococcus aureus [TaxId:93061] [189958] (1 PDB entry)
  8. 980972Domain d3qwdl_: 3qwd L: [184674]
    automated match to d1tyfa_
    complexed with cl

Details for d3qwdl_

PDB Entry: 3qwd (more details), 2.1 Å

PDB Description: Crystal structure of ClpP from Staphylococcus aureus
PDB Compounds: (L:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d3qwdl_:

Sequence, based on SEQRES records: (download)

>d3qwdl_ c.14.1.1 (L:) automated matches {Staphylococcus aureus [TaxId: 93061]}
liptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiyl
yinspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmi
hqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeake
yglidevmvpe

Sequence, based on observed residues (ATOM records): (download)

>d3qwdl_ c.14.1.1 (L:) automated matches {Staphylococcus aureus [TaxId: 93061]}
liptvieydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyinspggs
vtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplggqa
teieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvpe

SCOPe Domain Coordinates for d3qwdl_:

Click to download the PDB-style file with coordinates for d3qwdl_.
(The format of our PDB-style files is described here.)

Timeline for d3qwdl_: