Lineage for d3qw1a_ (3qw1 A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1083284Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1083319Superfamily a.24.3: Cytochromes [47175] (2 families) (S)
    Heme-containing proteins
  5. 1083320Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
  6. 1083331Protein automated matches [190502] (1 species)
    not a true protein
  7. 1083332Species Escherichia coli [TaxId:562] [187450] (25 PDB entries)
  8. 1083438Domain d3qw1a_: 3qw1 A: [184659]
    automated match to d1qq3a_
    complexed with hem, lcy, zn

Details for d3qw1a_

PDB Entry: 3qw1 (more details), 2.7 Å

PDB Description: Crystal structure of the Zn-RIDC1 complex stabilized by BMH crosslinks
PDB Compounds: (A:) Cytochrome cb562

SCOPe Domain Sequences for d3qw1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qw1a_ a.24.3.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwiligqihdalhlaneckvkeaqaaaeqlkttcnachqkyr

SCOPe Domain Coordinates for d3qw1a_:

Click to download the PDB-style file with coordinates for d3qw1a_.
(The format of our PDB-style files is described here.)

Timeline for d3qw1a_: