SCOPe 2.01: Domain d3qtlb_: 3qtl B:

Lineage for d3qtlb_ (3qtl B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.41: Subtilisin-like [52742] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3

4. Superfamily c.41.1: Subtilisin-like [52743] (3 families)

5. Family c.41.1.1: Subtilases [52744] (14 proteins)

6. Protein automated matches [190073] (9 species)
   not a true protein

7. Species Bacillus licheniformis [TaxId:1402] [186887] (4 PDB entries)

8. Domain d3qtlb_: 3qtl B: [184622]
   automated match to d1af4a_

Details for d3qtlb_

PDB Entry: 3qtl, 2.6 Å

PDB Description: structural basis for dual-inhibition mechanism of a non-classical kazal-type serine protease inhibitor from horseshoe crab in complex with subtilisin

PDB Compounds: (B:) Subtilisin-like serin protease

SCOPe Domain Sequences for d3qtlb_:

Sequence; same for both SEQRES and ATOM records:

>d3qtlb_ c.41.1.1 (B:) automated matches {Bacillus licheniformis [TaxId: 1402]}
aqtvpygiplikadkvqaqgfkganvkvavldtgiqashpdlnvvggasfvageayntdg
nghgthvagtvaaldnttgvlgvapsvslyavkvlnssgsgsysgivsgiewattngmdv
inmslggasgstamkqavdnayargvvvvaaagnsgssgntntigypakydsviavgavd
snsnrasfssvgaelevmapgagvystyptntyatlngtsmasphvagaaalilskhpnl
sasqvrnrlsstatylgssfyygkglinveaaaq

Timeline for d3qtlb_:

• d3qtlb_ is new in SCOPe 2.01-stable
  
• d3qtlb_ appears in SCOPe 2.02
  
• d3qtlb_ appears in the current release, SCOPe 2.08