SCOP 1.69: Domain d1crkc1: 1crk C:1-98

Lineage for d1crkc1 (1crk C:1-98)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (1 family)

5. Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)

6. Protein Creatine kinase, N-domain [48036] (7 species)

7. Species Chicken (Gallus gallus), mitochondria [TaxId:9031] [48037] (1 PDB entry)

8. Domain d1crkc1: 1crk C:1-98 [18460]
   Other proteins in same PDB: d1crka2, d1crkb2, d1crkc2, d1crkd2

Details for d1crkc1

PDB Entry: 1crk, 3 Å

PDB Description: mitochondrial creatine kinase

SCOP Domain Sequences for d1crkc1:

Sequence; same for both SEQRES and ATOM records:

>d1crkc1 a.83.1.1 (C:1-98) Creatine kinase, N-domain {Chicken (Gallus gallus), mitochondria}
tvhekrklfppsadypdlrkhnncmaecltpaiyaklrdkltpngysldqciqtgvdnpg
hpfiktvgmvagdeesyevfaeifdpvikarhngydpr

Timeline for d1crkc1:

• d1crkc1 first appeared (with stable ids) in SCOP 1.55
  
• d1crkc1 appears in SCOP 1.67
  
• d1crkc1 appears in SCOP 1.71
  
• d1crkc1 appears in the current release, SCOPe 2.08