Lineage for d1crkc1 (1crk C:1-98)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5055Fold a.83: Guanido kinases [48033] (1 superfamily)
  4. 5056Superfamily a.83.1: Guanido kinases [48034] (1 family) (S)
  5. 5057Family a.83.1.1: Guanido kinases [48035] (2 proteins)
  6. 5061Protein Creatine kinase, N-terminal domain [48036] (5 species)
  7. 5067Species Chicken (Gallus gallus), mitochondria [TaxId:9031] [48037] (1 PDB entry)
  8. 5070Domain d1crkc1: 1crk C:1-98 [18460]
    Other proteins in same PDB: d1crka2, d1crkb2, d1crkc2, d1crkd2

Details for d1crkc1

PDB Entry: 1crk (more details), 3 Å

PDB Description: mitochondrial creatine kinase

SCOP Domain Sequences for d1crkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1crkc1 a.83.1.1 (C:1-98) Creatine kinase, N-terminal domain {Chicken (Gallus gallus), mitochondria}
tvhekrklfppsadypdlrkhnncmaecltpaiyaklrdkltpngysldqciqtgvdnpg
hpfiktvgmvagdeesyevfaeifdpvikarhngydpr

SCOP Domain Coordinates for d1crkc1:

Click to download the PDB-style file with coordinates for d1crkc1.
(The format of our PDB-style files is described here.)

Timeline for d1crkc1: