Lineage for d3qo2a_ (3qo2 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1311416Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 1311567Family b.34.13.0: automated matches [191621] (1 protein)
    not a true family
  6. 1311568Protein automated matches [191139] (2 species)
    not a true protein
  7. 1311572Species Human (Homo sapiens) [TaxId:9606] [189257] (6 PDB entries)
  8. 1311583Domain d3qo2a_: 3qo2 A: [184543]
    automated match to d2dnta1
    protein/DNA complex; complexed with edo

Details for d3qo2a_

PDB Entry: 3qo2 (more details), 2.49 Å

PDB Description: structural insights for mpp8 chromodomain interaction with histone h3 lysine 9
PDB Compounds: (A:) M-phase phosphoprotein 8

SCOPe Domain Sequences for d3qo2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qo2a_ b.34.13.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgedvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaen
k

SCOPe Domain Coordinates for d3qo2a_:

Click to download the PDB-style file with coordinates for d3qo2a_.
(The format of our PDB-style files is described here.)

Timeline for d3qo2a_: