PDB entry 3qo2

View 3qo2 on RCSB PDB site
Description: Structural insights for MPP8 chromodomain interaction with histone H3 lysine 9
Class: DNA binding protein/gene regulation
Keywords: epigenetics, MPP8 phosphorylation, chromodomain, MPP8-H3K9me modulates the expression of E-cadherin, H3K9 methyl-lysine binding, tri-methyl-lysine, DNA BINDING PROTEIN-GENE REGULATION complex, Histone H3 tail Binding Protein
Deposited on 2011-02-09, released 2011-04-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.218
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: M-phase phosphoprotein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: MPHOSPH8, MPP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99549 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.03: d3qo2a_
  • Chain 'B':
    Compound: M-phase phosphoprotein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: MPHOSPH8, MPP8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3qo2b_
  • Chain 'C':
    Compound: M-phase phosphoprotein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: MPHOSPH8, MPP8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3qo2c_
  • Chain 'D':
    Compound: M-phase phosphoprotein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: MPHOSPH8, MPP8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3qo2d_
  • Chain 'P':
    Compound: histone h3 peptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QO2 (0-14)
  • Chain 'Q':
    Compound: histone h3 peptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QO2 (Start-14)
  • Chain 'R':
    Compound: histone h3 peptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QO2 (Start-14)
  • Chain 'S':
    Compound: histone h3 peptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QO2 (0-14)
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qo2A (A:)
    hmgedvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiae
    nkak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qo2A (A:)
    mgedvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaen
    k
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qo2B (B:)
    hmgedvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiae
    nkak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qo2B (B:)
    dvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qo2C (C:)
    hmgedvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiae
    nkak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qo2C (C:)
    edvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3qo2D (D:)
    hmgedvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiae
    nkak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qo2D (D:)
    edvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenk
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.