SCOPe 2.06: Domain d3qnma1: 3qnm A:2-230

Lineage for d3qnma1 (3qnm A:2-230)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (51 species)
   not a true protein

7. Species Bacteroides thetaiotaomicron [TaxId:818] [189385] (21 PDB entries)

8. Domain d3qnma1: 3qnm A:2-230 [184542]
   Other proteins in same PDB: d3qnma2, d3qnma3
   automated match to d2gfha1
   complexed with cl, mg

Details for d3qnma1

PDB Entry: 3qnm, 1.7 Å

PDB Description: haloalkane dehalogenase family member from bacteroides thetaiotaomicron of unknown function

PDB Compounds: (A:) Haloacid dehalogenase-like hydrolase

SCOPe Domain Sequences for d3qnma1:

Sequence; same for both SEQRES and ATOM records:

>d3qnma1 c.108.1.0 (A:2-230) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
kyknlffdlddtiwafsrnardtfeevyqkysfdryfdsfdhyytlyqrrntelwleyge
gkvtkeelnrqrffyplqavgvedealaerfsedffaiiptksglmphakevleylapqy
nlyilsngfrelqsrkmrsagvdryfkkiilsedlgvlkprpeifhfalsatqselresl
migdsweaditgahgvgmhqafynvtertvfpfqptyhihslkelmnll

Timeline for d3qnma1:

• d3qnma1 first appeared in SCOPe 2.01, called d3qnma_
  
• d3qnma1 was called d3qnma_ in SCOPe 2.05
  
• d3qnma1 appears in SCOPe 2.07
  
• d3qnma1 appears in the current release, SCOPe 2.08