Class b: All beta proteins [48724] (180 folds) |
Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) |
Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins) automatically mapped to Pfam PF00541 |
Protein Adenovirus fiber protein 'knob' domain [49837] (18 species) |
Species Human adenovirus 37 [TaxId:52275] [110136] (11 PDB entries) Uniprot Q64823 182-365 ! Uniprot Q64823 181-365 |
Domain d3qndc_: 3qnd C: [184538] automated match to d1uxaa_ complexed with sia, zn |
PDB Entry: 3qnd (more details), 2.4 Å
SCOPe Domain Sequences for d3qndc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qndc_ b.21.1.1 (C:) Adenovirus fiber protein 'knob' domain {Human adenovirus 37 [TaxId: 52275]} trtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpkik sftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskky ardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsyi aqe
Timeline for d3qndc_: