SCOP 1.67: Domain d1eyva_: 1eyv A:

Lineage for d1eyva_ (1eyv A:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.79: NusB-like [48012] (1 superfamily)
   6 helices: bundle; one central helix is surrounded by 5 others

4. Superfamily a.79.1: NusB-like [48013] (2 families)

5. Family a.79.1.1: Antitermination factor NusB [48014] (1 protein)

6. Protein Antitermination factor NusB [48015] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [48016] (1 PDB entry)

8. Domain d1eyva_: 1eyv A: [18446]

Details for d1eyva_

PDB Entry: 1eyv, 1.6 Å

PDB Description: the crystal structure of nusb from mycobacterium tuberculosis

SCOP Domain Sequences for d1eyva_:

Sequence; same for both SEQRES and ATOM records:

>d1eyva_ a.79.1.1 (A:) Antitermination factor NusB {Mycobacterium tuberculosis}
grhqarkravallfeaevrgisaaevvdtraalaeakpdiarlhpytaavargvsehaah
iddlitahlrgwtldrlpavdrailrvsvwellhaadvpepvvvdeavqlakelstddsp
gfvngvlgqvm

Timeline for d1eyva_:

• d1eyva_ first appeared (with stable ids) in SCOP 1.55
  
• d1eyva_ appears in SCOP 1.65
  
• d1eyva_ appears in SCOP 1.69
  
• d1eyva_ appears in the current release, SCOPe 2.08