SCOPe 2.07: Domain d3qioa1: 3qio A:427-559

Lineage for d3qioa1 (3qio A:427-559)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)

7. Species Hiv-1 m:b_hxb2r [TaxId:11706] [224897] (8 PDB entries)

8. Domain d3qioa1: 3qio A:427-559 [184408]
   Other proteins in same PDB: d3qioa2
   automated match to d1o1wa_
   complexed with mn, qid, so4

Details for d3qioa1

PDB Entry: 3qio, 1.4 Å

PDB Description: crystal structure of hiv-1 rnase h with engineered e. coli loop and n- hydroxy quinazolinedione inhibitor

PDB Compounds: (A:) Gag-Pol polyprotein,Ribonuclease HI,Gag-Pol polyprotein

SCOPe Domain Sequences for d3qioa1:

Sequence, based on SEQRES records:

>d3qioa1 c.55.3.1 (A:427-559) HIV RNase H (Domain of reverse transcriptase) {Hiv-1 m:b_hxb2r [TaxId: 11706]}
yqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylal
qdsglevnivtdsqyalgiitqwihnwkkrgwktadkkpvknvdlvnqiieqlikkekvy
lawvpahkgiggneqvdklvsagirkv

Sequence, based on observed residues (ATOM records):

>d3qioa1 c.55.3.1 (A:427-559) HIV RNase H (Domain of reverse transcriptase) {Hiv-1 m:b_hxb2r [TaxId: 11706]}
yqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylal
qdsglevnivtdsqyalgiitqwihnwkknvdlvnqiieqlikkekvylawvpahkgigg
neqvdklvsagirkv

Timeline for d3qioa1:

• d3qioa1 first appeared in SCOPe 2.01, called d3qioa_
  
• d3qioa1 appears in SCOPe 2.06
  
• d3qioa1 appears in the current release, SCOPe 2.08