Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) consists of one domain of this fold |
Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species) |
Species Hiv-1 m:b_hxb2r [TaxId:11706] [224897] (8 PDB entries) |
Domain d3qioa1: 3qio A:427-559 [184408] Other proteins in same PDB: d3qioa2 automated match to d1o1wa_ complexed with mn, qid, so4 |
PDB Entry: 3qio (more details), 1.4 Å
SCOPe Domain Sequences for d3qioa1:
Sequence, based on SEQRES records: (download)
>d3qioa1 c.55.3.1 (A:427-559) HIV RNase H (Domain of reverse transcriptase) {Hiv-1 m:b_hxb2r [TaxId: 11706]} yqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylal qdsglevnivtdsqyalgiitqwihnwkkrgwktadkkpvknvdlvnqiieqlikkekvy lawvpahkgiggneqvdklvsagirkv
>d3qioa1 c.55.3.1 (A:427-559) HIV RNase H (Domain of reverse transcriptase) {Hiv-1 m:b_hxb2r [TaxId: 11706]} yqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylal qdsglevnivtdsqyalgiitqwihnwkknvdlvnqiieqlikkekvylawvpahkgigg neqvdklvsagirkv
Timeline for d3qioa1: