Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (83 species) not a true protein |
Species Mycobacterium ulcerans [TaxId:362242] [189655] (2 PDB entries) |
Domain d3qhxa_: 3qhx A: [184390] automated match to d1n8pa_ complexed with epe, gol, na, so4 |
PDB Entry: 3qhx (more details), 1.65 Å
SCOPe Domain Sequences for d3qhxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qhxa_ c.67.1.0 (A:) automated matches {Mycobacterium ulcerans [TaxId: 362242]} aglatraihsgyrpdpatgavnapiyasstfaqdgvgglrggyeyartgnptrtaleaal aavedaafgrafssgmaaadcalramlrpgdhvvipddayggtfrlidkvftgwnveytp valadldavraairpttrliwvetptnpllsiadiagiaqlgadssakvlvdntfaspal qqplslgadvvlhsttkyigghsdvvggalvtndeeldqsfaflqngagavpgpfdaylt mrglktlvlrmqrhsenaaavaeflaehpaistvlypglpshpghavaarqmrgfggmvs vrmragrtaaeqlcaktnifilaeslgsvesliehpsamthastagsqlevpddlvrlsv giedvadllddlkqalg
Timeline for d3qhxa_: