Lineage for d3qdxb_ (3qdx B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1333738Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
    sandwich, 10 strands in 2 sheets;
  4. 1333739Superfamily b.97.1: Cytolysin/lectin [63724] (2 families) (S)
    some topological similarity to osmotin
  5. 1333755Family b.97.1.2: Fungal fruit body lectin [117119] (3 proteins)
    Pfam PF07367
  6. 1333774Protein automated matches [190758] (3 species)
    not a true protein
  7. 1333782Species Boletus edulis [TaxId:36056] [189648] (7 PDB entries)
  8. 1333790Domain d3qdxb_: 3qdx B: [184358]
    automated match to d1x99a_
    complexed with cbs

Details for d3qdxb_

PDB Entry: 3qdx (more details), 1.7 Å

PDB Description: structure of the orthorhombic form of the boletus edulis lectin in complex with t-antigen disaccharide and n,n-diacetyl chitobiose
PDB Compounds: (B:) boletus edulis lectin

SCOPe Domain Sequences for d3qdxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qdxb_ b.97.1.2 (B:) automated matches {Boletus edulis [TaxId: 36056]}
tysitlrvfqrnpgrgffsivektvfhyanggtwseakgthtltmggsgtsgvlrfmsdk
gelitvavgvhnykrwcdvvtglkpeetalvinpqyynngpraytrekqlaeynvtsvvg
trfevkytvvegnnleanvifs

SCOPe Domain Coordinates for d3qdxb_:

Click to download the PDB-style file with coordinates for d3qdxb_.
(The format of our PDB-style files is described here.)

Timeline for d3qdxb_: