Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily) core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane |
Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (2 families) |
Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins) |
Protein Sensory rhodopsin II [64526] (1 species) |
Species Natronobacterium pharaonis [TaxId:2257] [64527] (9 PDB entries) |
Domain d3qapa_: 3qap A: [184310] automated match to d1h2sa_ complexed with bog, l2p, lfa, ret |
PDB Entry: 3qap (more details), 1.9 Å
SCOPe Domain Sequences for d3qapa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qapa_ f.13.1.1 (A:) Sensory rhodopsin II {Natronobacterium pharaonis [TaxId: 2257]} mvglttlfwlgaigmlvgtlafawagrdagsgerryyvtlvgisgiaavayvvmalgvgw vpvaertvfapryidwilttplivyflgllagldsrefgivitlntvvmlagfagamvpg ieryalfgmgavaflglvyylvgpmtesasqrssgikslyvrlrnltvilwaiypfiwll gppgvalltptvdvalivyldlvtkvgfgfialdaaatl
Timeline for d3qapa_: