SCOPe 2.01: Domain d3qapa_: 3qap A:

Lineage for d3qapa_ (3qap A:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (2 families)

5. Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)

6. Protein Sensory rhodopsin II [64526] (1 species)

7. Species Natronobacterium pharaonis [TaxId:2257] [64527] (9 PDB entries)

8. Domain d3qapa_: 3qap A: [184310]
   automated match to d1h2sa_
   complexed with bog, l2p, lfa, ret

Details for d3qapa_

PDB Entry: 3qap, 1.9 Å

PDB Description: crystal structure of natronomonas pharaonis sensory rhodopsin ii in the ground state

PDB Compounds: (A:) Sensory rhodopsin-2

SCOPe Domain Sequences for d3qapa_:

Sequence; same for both SEQRES and ATOM records:

>d3qapa_ f.13.1.1 (A:) Sensory rhodopsin II {Natronobacterium pharaonis [TaxId: 2257]}
mvglttlfwlgaigmlvgtlafawagrdagsgerryyvtlvgisgiaavayvvmalgvgw
vpvaertvfapryidwilttplivyflgllagldsrefgivitlntvvmlagfagamvpg
ieryalfgmgavaflglvyylvgpmtesasqrssgikslyvrlrnltvilwaiypfiwll
gppgvalltptvdvalivyldlvtkvgfgfialdaaatl

Timeline for d3qapa_:

• d3qapa_ is new in SCOPe 2.01-stable
  
• d3qapa_ appears in SCOPe 2.02
  
• d3qapa_ appears in the current release, SCOPe 2.08