Lineage for d2ygsa_ (2ygs A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 99310Fold a.77: DEATH domain [47985] (1 superfamily)
  4. 99311Superfamily a.77.1: DEATH domain [47986] (1 family) (S)
  5. 99312Family a.77.1.1: DEATH domain [47987] (9 proteins)
  6. 99313Protein Apoptotic protease activating factor 1, APAF-1 [47997] (1 species)
  7. 99314Species Human (Homo sapiens) [TaxId:9606] [47998] (5 PDB entries)
  8. 99316Domain d2ygsa_: 2ygs A: [18431]

Details for d2ygsa_

PDB Entry: 2ygs (more details), 1.6 Å

PDB Description: card domain from apaf-1

SCOP Domain Sequences for d2ygsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ygsa_ a.77.1.1 (A:) Apoptotic protease activating factor 1, APAF-1 {Human (Homo sapiens)}
mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi
lkkdndsyvsfynallhegykdlaallhdgip

SCOP Domain Coordinates for d2ygsa_:

Click to download the PDB-style file with coordinates for d2ygsa_.
(The format of our PDB-style files is described here.)

Timeline for d2ygsa_: