Lineage for d3q90a_ (3q90 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1640316Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1640820Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1641515Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 1641516Protein automated matches [190205] (19 species)
    not a true protein
  7. 1641542Species Human (Homo sapiens) [TaxId:9606] [189642] (3 PDB entries)
  8. 1641543Domain d3q90a_: 3q90 A: [184278]
    automated match to d1zo2a1

Details for d3q90a_

PDB Entry: 3q90 (more details), 1.7 Å

PDB Description: Crystal structure of the NTF2 domain of Ras GTPase-activating protein-binding protein 1
PDB Compounds: (A:) Ras GTPase-activating protein-binding protein 1

SCOPe Domain Sequences for d3q90a_:

Sequence, based on SEQRES records: (download)

>d3q90a_ d.17.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spllvgrefvrqyytllnqapdmlhrfygknssyvhggldsngkpadavygqkeihrkvm
sqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapegsvankfyv
hndifryqdev

Sequence, based on observed residues (ATOM records): (download)

>d3q90a_ d.17.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spllvgrefvrqyytllnqapdmlhrfygknssyvadavygqkeihrkvmsqnftnchtk
irhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapegsvankfyvhndifryqde
v

SCOPe Domain Coordinates for d3q90a_:

Click to download the PDB-style file with coordinates for d3q90a_.
(The format of our PDB-style files is described here.)

Timeline for d3q90a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3q90b_