SCOPe 2.04: Domain d3q90a_: 3q90 A:

Lineage for d3q90a_ (3q90 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189642] (3 PDB entries)

8. Domain d3q90a_: 3q90 A: [184278]
   automated match to d1zo2a1

Details for d3q90a_

PDB Entry: 3q90, 1.7 Å

PDB Description: Crystal structure of the NTF2 domain of Ras GTPase-activating protein-binding protein 1

PDB Compounds: (A:) Ras GTPase-activating protein-binding protein 1

SCOPe Domain Sequences for d3q90a_:

Sequence, based on SEQRES records:

>d3q90a_ d.17.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spllvgrefvrqyytllnqapdmlhrfygknssyvhggldsngkpadavygqkeihrkvm
sqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapegsvankfyv
hndifryqdev

Sequence, based on observed residues (ATOM records):

>d3q90a_ d.17.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spllvgrefvrqyytllnqapdmlhrfygknssyvadavygqkeihrkvmsqnftnchtk
irhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapegsvankfyvhndifryqde
v

Timeline for d3q90a_:

• d3q90a_ first appeared in SCOPe 2.01
  
• d3q90a_ appears in SCOPe 2.03
  
• d3q90a_ appears in SCOPe 2.05
  
• d3q90a_ appears in the current release, SCOPe 2.08