![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.77: DEATH domain [47985] (1 superfamily) 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry |
![]() | Superfamily a.77.1: DEATH domain [47986] (5 families) ![]() |
![]() | Family a.77.1.2: DEATH domain, DD [81312] (9 proteins) Pfam PF00531 |
![]() | Protein FADD (Mort1) [47992] (2 species) contains two domains of this superfamily: DED and DD, in this order |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47993] (4 PDB entries) |
![]() | Domain d1e41a1: 1e41 A:93-192 [18424] Other proteins in same PDB: d1e41a2 |
PDB Entry: 1e41 (more details)
SCOPe Domain Sequences for d1e41a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e41a1 a.77.1.2 (A:93-192) FADD (Mort1) {Human (Homo sapiens) [TaxId: 9606]} geedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriwknte kenatvahlvgalrscqmnlvadlvqevqqardlqnrsga
Timeline for d1e41a1: