SCOPe 2.06: Domain d3q4pa_: 3q4p A:

Lineage for d3q4pa_ (3q4p A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein automated matches [190420] (8 species)
   not a true protein

7. Species Momordica balsamina [TaxId:3672] [189375] (74 PDB entries)

8. Domain d3q4pa_: 3q4p A: [184210]
   automated match to d1ahaa_
   complexed with gol, m7g, nag, peg

Details for d3q4pa_

PDB Entry: 3q4p, 1.8 Å

PDB Description: crystal structure of the complex of type i ribosome inactivating protein with 7n-methyl -8-hydroguanosine-5-p-diphosphate at 1.8 a resolution

PDB Compounds: (A:) Ribosome inactivating protein

SCOPe Domain Sequences for d3q4pa_:

Sequence; same for both SEQRES and ATOM records:

>d3q4pa_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]}
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni

Timeline for d3q4pa_:

• d3q4pa_ first appeared in SCOPe 2.01
  
• d3q4pa_ appears in SCOPe 2.05
  
• d3q4pa_ appears in SCOPe 2.07
  
• d3q4pa_ appears in the current release, SCOPe 2.08