Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) |
Family d.165.1.1: Plant cytotoxins [56372] (18 proteins) |
Protein automated matches [190420] (8 species) not a true protein |
Species Momordica balsamina [TaxId:3672] [189375] (74 PDB entries) |
Domain d3q4pa_: 3q4p A: [184210] automated match to d1ahaa_ complexed with gol, m7g, nag, peg |
PDB Entry: 3q4p (more details), 1.8 Å
SCOPe Domain Sequences for d3q4pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q4pa_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]} dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll lntkni
Timeline for d3q4pa_: