SCOPe 2.04: Domain d3q4ga_: 3q4g A:

Lineage for d3q4ga_ (3q4g A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (16 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [189621] (1 PDB entry)

8. Domain d3q4ga_: 3q4g A: [184208]
   automated match to d1ee1a_
   complexed with ca

Details for d3q4ga_

PDB Entry: 3q4g, 2.4 Å

PDB Description: Structure of NAD synthetase from Vibrio cholerae

PDB Compounds: (A:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d3q4ga_:

Sequence, based on SEQRES records:

>d3q4ga_ c.26.2.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
snamehkireemrvlpsidpqfeierrvafikrkltearykslvlgisggvdsttcgrla
qlaveelnqqhntteyqfiavrlpygeqkdedeaqlalsfirpthsvsvnikagvdglha
ashhalantglipsdpakvdfikgnvkararmvaqyeiagyvgglvlgtdhsaenitgfy
tkfgdgacdlaplfglnkrqvrllaktlgapeqlvyktptadleelapqkadeaalnlty
eqiddflegkavpaevsqrlvaiyhatqhkrqpiptiyd

Sequence, based on observed residues (ATOM records):

>d3q4ga_ c.26.2.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
snamehkireemrvlpsidpqfeierrvafikrkltearykslvlgisggvdsttcgrla
qlaveelnqqhntteyqfiavrlpygeqkdedeaqlalsfirpthsvsvnikagvdglha
ashhalantglipsdpakvdfikgnvkararmvaqyeiagyvgglvlgtdhsaenitgfy
tkfgdgacdlaplfglnkrqvrllaktlgapeqlvyktptadlnltyeqiddflegkavp
aevsqrlvaiyhatqhkrqpiptiyd

Timeline for d3q4ga_:

• d3q4ga_ first appeared in SCOPe 2.01
  
• d3q4ga_ appears in SCOPe 2.03
  
• d3q4ga_ appears in SCOPe 2.05
  
• d3q4ga_ appears in the current release, SCOPe 2.08, called d3q4ga1