Lineage for d3q4ga_ (3q4g A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1160658Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1161262Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1161512Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 1161513Protein automated matches [190116] (9 species)
    not a true protein
  7. 1161552Species Vibrio cholerae [TaxId:243277] [189621] (1 PDB entry)
  8. 1161553Domain d3q4ga_: 3q4g A: [184208]
    automated match to d1ee1a_
    complexed with ca

Details for d3q4ga_

PDB Entry: 3q4g (more details), 2.4 Å

PDB Description: Structure of NAD synthetase from Vibrio cholerae
PDB Compounds: (A:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d3q4ga_:

Sequence, based on SEQRES records: (download)

>d3q4ga_ c.26.2.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
snamehkireemrvlpsidpqfeierrvafikrkltearykslvlgisggvdsttcgrla
qlaveelnqqhntteyqfiavrlpygeqkdedeaqlalsfirpthsvsvnikagvdglha
ashhalantglipsdpakvdfikgnvkararmvaqyeiagyvgglvlgtdhsaenitgfy
tkfgdgacdlaplfglnkrqvrllaktlgapeqlvyktptadleelapqkadeaalnlty
eqiddflegkavpaevsqrlvaiyhatqhkrqpiptiyd

Sequence, based on observed residues (ATOM records): (download)

>d3q4ga_ c.26.2.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
snamehkireemrvlpsidpqfeierrvafikrkltearykslvlgisggvdsttcgrla
qlaveelnqqhntteyqfiavrlpygeqkdedeaqlalsfirpthsvsvnikagvdglha
ashhalantglipsdpakvdfikgnvkararmvaqyeiagyvgglvlgtdhsaenitgfy
tkfgdgacdlaplfglnkrqvrllaktlgapeqlvyktptadlnltyeqiddflegkavp
aevsqrlvaiyhatqhkrqpiptiyd

SCOPe Domain Coordinates for d3q4ga_:

Click to download the PDB-style file with coordinates for d3q4ga_.
(The format of our PDB-style files is described here.)

Timeline for d3q4ga_: