SCOPe 2.06: Domain d3q3mh_: 3q3m H:

Lineage for d3q3mh_ (3q3m H:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
   corner-like structure formed by two sheets and filled in with 2-3 helices

4. Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family)
   duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold

5. Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins)
   note: the solution structure determinations disagree in the relative orientations of two motifs

6. Protein Toluene-4-monooxygenase catalytic effector protein [64394] (1 species)

7. Species Pseudomonas mendocina [TaxId:300] [64395] (18 PDB entries)

8. Domain d3q3mh_: 3q3m H: [184191]
   Other proteins in same PDB: d3q3ma_, d3q3mc_, d3q3md_, d3q3mg_
   automated match to d1g10a_
   complexed with fe, z82

Details for d3q3mh_

PDB Entry: 3q3m, 1.75 Å

PDB Description: toluene 4 monooxygenase hd complex with inhibitor 4-bromobenzoate

PDB Compounds: (H:) toluene-4-monooxygenase system protein d

SCOPe Domain Sequences for d3q3mh_:

Sequence; same for both SEQRES and ATOM records:

>d3q3mh_ d.137.1.1 (H:) Toluene-4-monooxygenase catalytic effector protein {Pseudomonas mendocina [TaxId: 300]}
stladqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltr
ktleeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm

Timeline for d3q3mh_:

• d3q3mh_ first appeared in SCOPe 2.01
  
• d3q3mh_ appears in SCOPe 2.05
  
• d3q3mh_ appears in SCOPe 2.07
  
• d3q3mh_ appears in the current release, SCOPe 2.08