Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily) corner-like structure formed by two sheets and filled in with 2-3 helices |
Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold |
Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins) note: the solution structure determinations disagree in the relative orientations of two motifs |
Protein Toluene-4-monooxygenase catalytic effector protein [64394] (1 species) |
Species Pseudomonas mendocina [TaxId:300] [64395] (15 PDB entries) |
Domain d3q3me_: 3q3m E: [184189] Other proteins in same PDB: d3q3ma_, d3q3mc_, d3q3md_, d3q3mg_ automated match to d1g10a_ complexed with fe, z82 |
PDB Entry: 3q3m (more details), 1.75 Å
SCOPe Domain Sequences for d3q3me_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q3me_ d.137.1.1 (E:) Toluene-4-monooxygenase catalytic effector protein {Pseudomonas mendocina [TaxId: 300]} stladqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltr ktleeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm
Timeline for d3q3me_: