Lineage for d3q10b1 (3q10 B:1-284)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860642Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins)
    contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family
    automatically mapped to Pfam PF02569
  6. 2860753Protein automated matches [191096] (2 species)
    not a true protein
  7. 2860757Species Yersinia pestis [TaxId:632] [189627] (2 PDB entries)
  8. 2860763Domain d3q10b1: 3q10 B:1-284 [184136]
    Other proteins in same PDB: d3q10a2, d3q10b2, d3q10c2, d3q10d2
    automated match to d1ihoa_
    complexed with amp, cl, gol, imd

Details for d3q10b1

PDB Entry: 3q10 (more details), 1.83 Å

PDB Description: pantoate-beta-alanine ligase from yersinia pestis
PDB Compounds: (B:) Pantoate--beta-alanine ligase

SCOPe Domain Sequences for d3q10b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q10b1 c.26.1.4 (B:1-284) automated matches {Yersinia pestis [TaxId: 632]}
mliietlpllrqqirrwrqegkrialvptmgnlheghmtlvdeaktradvvvvtifvnpl
qferpddlahyprtlqedcekltrhgadlvfapaaadiypaglekqtyvdvpalstileg
asrpghfrgvstivsklfnliqpdvacfgekdyqqlalirkmvadmgydinivgvptvra
kdglalssrngylteeerqiapqlskimwalaekmalgerqidalleeaaaqllrvgftp
delfirdaetlqpltvdsqqavilmaawlgkarlidnqlvdlrh

SCOPe Domain Coordinates for d3q10b1:

Click to download the PDB-style file with coordinates for d3q10b1.
(The format of our PDB-style files is described here.)

Timeline for d3q10b1: