PDB entry 3q10

View 3q10 on RCSB PDB site
Description: Pantoate-beta-alanine ligase from Yersinia pestis
Class: ligase
Keywords: structural genomics, Center for Structural Genomics of Infectious Diseases, CSGID, ligase
Deposited on 2010-12-16, released 2011-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pantoate--beta-alanine ligase
    Species: Yersinia pestis [TaxId:632]
    Gene: panC, y0785, YPO3402, YP_0283
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZBK7 (3-286)
      • expression tag (2)
    Domains in SCOPe 2.07: d3q10a1, d3q10a2
  • Chain 'B':
    Compound: Pantoate--beta-alanine ligase
    Species: Yersinia pestis [TaxId:632]
    Gene: panC, y0785, YPO3402, YP_0283
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZBK7 (3-286)
      • expression tag (2)
    Domains in SCOPe 2.07: d3q10b1, d3q10b2
  • Chain 'C':
    Compound: Pantoate--beta-alanine ligase
    Species: Yersinia pestis [TaxId:632]
    Gene: panC, y0785, YPO3402, YP_0283
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZBK7 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3q10c1, d3q10c2
  • Chain 'D':
    Compound: Pantoate--beta-alanine ligase
    Species: Yersinia pestis [TaxId:632]
    Gene: panC, y0785, YPO3402, YP_0283
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZBK7 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d3q10d1, d3q10d2
  • Heterogens: AMP, GOL, IMD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3q10A (A:)
    snamliietlpllrqqirrwrqegkrialvptmgnlheghmtlvdeaktradvvvvtifv
    nplqferpddlahyprtlqedcekltrhgadlvfapaaadiypaglekqtyvdvpalsti
    legasrpghfrgvstivsklfnliqpdvacfgekdyqqlalirkmvadmgydinivgvpt
    vrakdglalssrngylteeerqiapqlskimwalaekmalgerqidalleeaaaqllrvg
    ftpdelfirdaetlqpltvdsqqavilmaawlgkarlidnqlvdlrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q10A (A:)
    amliietlpllrqqirrwrqegkrialvptmgnlheghmtlvdeaktradvvvvtifvnp
    lqferpddlahyprtlqedcekltrhgadlvfapaaadiypaglekqtyvdvpalstile
    gasrpghfrgvstivsklfnliqpdvacfgekdyqqlalirkmvadmgydinivgvptvr
    akdglalssrngylteeerqiapqlskimwalaekmalgerqidalleeaaaqllrvgft
    pdelfirdaetlqpltvdsqqavilmaawlgkarlidnqlvdlrh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3q10B (B:)
    snamliietlpllrqqirrwrqegkrialvptmgnlheghmtlvdeaktradvvvvtifv
    nplqferpddlahyprtlqedcekltrhgadlvfapaaadiypaglekqtyvdvpalsti
    legasrpghfrgvstivsklfnliqpdvacfgekdyqqlalirkmvadmgydinivgvpt
    vrakdglalssrngylteeerqiapqlskimwalaekmalgerqidalleeaaaqllrvg
    ftpdelfirdaetlqpltvdsqqavilmaawlgkarlidnqlvdlrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q10B (B:)
    amliietlpllrqqirrwrqegkrialvptmgnlheghmtlvdeaktradvvvvtifvnp
    lqferpddlahyprtlqedcekltrhgadlvfapaaadiypaglekqtyvdvpalstile
    gasrpghfrgvstivsklfnliqpdvacfgekdyqqlalirkmvadmgydinivgvptvr
    akdglalssrngylteeerqiapqlskimwalaekmalgerqidalleeaaaqllrvgft
    pdelfirdaetlqpltvdsqqavilmaawlgkarlidnqlvdlrh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3q10C (C:)
    snamliietlpllrqqirrwrqegkrialvptmgnlheghmtlvdeaktradvvvvtifv
    nplqferpddlahyprtlqedcekltrhgadlvfapaaadiypaglekqtyvdvpalsti
    legasrpghfrgvstivsklfnliqpdvacfgekdyqqlalirkmvadmgydinivgvpt
    vrakdglalssrngylteeerqiapqlskimwalaekmalgerqidalleeaaaqllrvg
    ftpdelfirdaetlqpltvdsqqavilmaawlgkarlidnqlvdlrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q10C (C:)
    namliietlpllrqqirrwrqegkrialvptmgnlheghmtlvdeaktradvvvvtifvn
    plqferpddlahyprtlqedcekltrhgadlvfapaaadiypaglekqtyvdvpalstil
    egasrpghfrgvstivsklfnliqpdvacfgekdyqqlalirkmvadmgydinivgvptv
    rakdglalssrngylteeerqiapqlskimwalaekmalgerqidalleeaaaqllrvgf
    tpdelfirdaetlqpltvdsqqavilmaawlgkarlidnqlvdl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3q10D (D:)
    snamliietlpllrqqirrwrqegkrialvptmgnlheghmtlvdeaktradvvvvtifv
    nplqferpddlahyprtlqedcekltrhgadlvfapaaadiypaglekqtyvdvpalsti
    legasrpghfrgvstivsklfnliqpdvacfgekdyqqlalirkmvadmgydinivgvpt
    vrakdglalssrngylteeerqiapqlskimwalaekmalgerqidalleeaaaqllrvg
    ftpdelfirdaetlqpltvdsqqavilmaawlgkarlidnqlvdlrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q10D (D:)
    amliietlpllrqqirrwrqegkrialvptmgnlheghmtlvdeaktradvvvvtifvnp
    lqferpddlahyprtlqedcekltrhgadlvfapaaadiypaglekqtyvdvpalstile
    gasrpghfrgvstivsklfnliqpdvacfgekdyqqlalirkmvadmgydinivgvptpd
    elfirvilmaaarlidnq