SCOPe 2.08: Domain d3q07b_: 3q07 B:

Lineage for d3q07b_ (3q07 B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein automated matches [190161] (29 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187306] (111 PDB entries)

8. Domain d3q07b_: 3q07 B: [184107]
   automated match to d1iysa_
   complexed with wpp, ypp

Details for d3q07b_

PDB Entry: 3q07, 1.5 Å

PDB Description: CTX-M-9 S70G in complex with piperacillin

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d3q07b_:

Sequence; same for both SEQRES and ATOM records:

>d3q07b_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
avqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqsetqk
qllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpggv
tafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraqlv
twlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftqpqq
naesrrdvlasaariiaegl

Timeline for d3q07b_:

• d3q07b_ first appeared in SCOPe 2.01
  
• d3q07b_ appears in SCOPe 2.07