Lineage for d1f5tb2 (1f5t B:2065-2121)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 357894Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 357895Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) (S)
  5. 357896Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins)
  6. 357897Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)
  7. 357898Species Corynebacterium diphtheriae [TaxId:1717] [47982] (15 PDB entries)
  8. 357914Domain d1f5tb2: 1f5t B:2065-2121 [18410]
    Other proteins in same PDB: d1f5ta1, d1f5tb1, d1f5tc1, d1f5td1

Details for d1f5tb2

PDB Entry: 1f5t (more details), 3 Å

PDB Description: diphtheria tox repressor (c102d mutant) complexed with nickel and dtxr consensus binding sequence

SCOP Domain Sequences for d1f5tb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5tb2 a.76.1.1 (B:2065-2121) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvlk

SCOP Domain Coordinates for d1f5tb2:

Click to download the PDB-style file with coordinates for d1f5tb2.
(The format of our PDB-style files is described here.)

Timeline for d1f5tb2: