SCOPe 2.01: Domain d3pzkb_: 3pzk B:

Lineage for d3pzkb_ (3pzk B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (10 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [189677] (1 PDB entry)

8. Domain d3pzkb_: 3pzk B: [184094]
   automated match to d1duba_
   complexed with so4

Details for d3pzkb_

PDB Entry: 3pzk, 2.23 Å

PDB Description: crystal structure of the mycobacterium tuberculosis crotonase in apo form

PDB Compounds: (B:) e enoyl-CoA hydratase echA8

SCOPe Domain Sequences for d3pzkb_:

Sequence; same for both SEQRES and ATOM records:

>d3pzkb_ c.14.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tyetilverdqrvgiitlnrpqalnalnsqvmnevtsaateldddpdigaiiitgsakaf
aagadikemadltfadaftadffatwgklaavrtptiaavagyalgggcelammcdvlia
adtakfgqpeiklgvlpgmggsqrltraigkakamdliltgrtmdaaeaersglvsrvvp
addlltearatattisqmsasaarmakeavnrafesslsegllyerrlfhsafatedqse
gmaafiekrapqf

Timeline for d3pzkb_:

• d3pzkb_ is new in SCOPe 2.01-stable
  
• d3pzkb_ appears in SCOPe 2.02
  
• d3pzkb_ appears in the current release, SCOPe 2.08