Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (10 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [189677] (1 PDB entry) |
Domain d3pzkb_: 3pzk B: [184094] automated match to d1duba_ complexed with so4 |
PDB Entry: 3pzk (more details), 2.23 Å
SCOPe Domain Sequences for d3pzkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pzkb_ c.14.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} tyetilverdqrvgiitlnrpqalnalnsqvmnevtsaateldddpdigaiiitgsakaf aagadikemadltfadaftadffatwgklaavrtptiaavagyalgggcelammcdvlia adtakfgqpeiklgvlpgmggsqrltraigkakamdliltgrtmdaaeaersglvsrvvp addlltearatattisqmsasaarmakeavnrafesslsegllyerrlfhsafatedqse gmaafiekrapqf
Timeline for d3pzkb_: