Class a: All alpha proteins [46456] (226 folds) |
Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) |
Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins) |
Protein Diphtheria toxin repressor (DtxR) [47981] (1 species) |
Species Corynebacterium diphtheriae [TaxId:1717] [47982] (16 PDB entries) |
Domain d2tdx_2: 2tdx 65-139 [18407] Other proteins in same PDB: d2tdx_1 complexed with ni; mutant |
PDB Entry: 2tdx (more details), 2.4 Å
SCOP Domain Sequences for d2tdx_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tdx_2 a.76.1.1 (65-139) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae} tptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvlkdvs rspfgnpipgldelg
Timeline for d2tdx_2: