Lineage for d3pvnl_ (3pvn L:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2389323Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
    automatically mapped to Pfam PF00354
  6. 2389324Protein C-reactive protein (CRP) [49954] (1 species)
  7. 2389325Species Human (Homo sapiens) [TaxId:9606] [49955] (6 PDB entries)
  8. 2389337Domain d3pvnl_: 3pvn L: [184006]
    automated match to d1b09a_
    complexed with ca, zn

Details for d3pvnl_

PDB Entry: 3pvn (more details), 1.98 Å

PDB Description: triclinic form of human c-reactive protein in complex with zinc
PDB Compounds: (L:) c-reactive protein

SCOPe Domain Sequences for d3pvnl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pvnl_ b.29.1.5 (L:) C-reactive protein (CRP) {Human (Homo sapiens) [TaxId: 9606]}
qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
spnvlnwralkyevqgevftkpqlwp

SCOPe Domain Coordinates for d3pvnl_:

Click to download the PDB-style file with coordinates for d3pvnl_.
(The format of our PDB-style files is described here.)

Timeline for d3pvnl_: