Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.58: MetI-like [161097] (1 superfamily) core: 5 transmembrane helices; flattened bundle |
Superfamily f.58.1: MetI-like [161098] (1 family) |
Family f.58.1.1: MetI-like [161099] (6 proteins) Pfam PF00528; Binding-protein-dependent transport system inner membrane component |
Protein automated matches [191243] (1 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [189709] (7 PDB entries) |
Domain d3puzg_: 3puz G: [183987] Other proteins in same PDB: d3puza1, d3puza2, d3puzb1, d3puzb2, d3puze_, d3puzf1, d3puzf2 automated match to d2r6gg1 complexed with anp, mal, mg, pgv |
PDB Entry: 3puz (more details), 2.9 Å
SCOPe Domain Sequences for d3puzg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3puzg_ f.58.1.1 (G:) automated matches {Escherichia coli K-12 [TaxId: 83333]} amvqpksqkarlfithlllllfiaaimfpllmvvaislrqgnfatgslipeqiswdhwkl algfsveqadgritpppfpvllwlwnsvkvagisaigivalsttcayafarmrfpgkatl lkgmlifqmfpavlslvalyalfdrlgeyipfiglnthggvifaylggialhvwtikgyf etidssleeaaaldgatpwqafrlvllplsvpilavvfilsfiaaitevpvaslllrdvn sytlavgmqqylnpqnylwgdfaaaavmsalpitivfllaqr
Timeline for d3puzg_: