SCOPe 2.01: Domain d3puzg_: 3puz G:

Lineage for d3puzg_ (3puz G:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.58: MetI-like [161097] (1 superfamily)
   core: 5 transmembrane helices; flattened bundle

4. Superfamily f.58.1: MetI-like [161098] (1 family)

5. Family f.58.1.1: MetI-like [161099] (6 proteins)
   Pfam PF00528; Binding-protein-dependent transport system inner membrane component

6. Protein automated matches [191243] (1 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189709] (6 PDB entries)

8. Domain d3puzg_: 3puz G: [183987]
   Other proteins in same PDB: d3puze_
   automated match to d2r6gg1
   complexed with anp, mal, mg, pgv

Details for d3puzg_

PDB Entry: 3puz, 2.9 Å

PDB Description: crystal structure of a pre-translocation state mbp-maltose transporter complex bound to amp-pnp

PDB Compounds: (G:) Maltose transporter subunit; membrane component of ABC superfamily

SCOPe Domain Sequences for d3puzg_:

Sequence; same for both SEQRES and ATOM records:

>d3puzg_ f.58.1.1 (G:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
amvqpksqkarlfithlllllfiaaimfpllmvvaislrqgnfatgslipeqiswdhwkl
algfsveqadgritpppfpvllwlwnsvkvagisaigivalsttcayafarmrfpgkatl
lkgmlifqmfpavlslvalyalfdrlgeyipfiglnthggvifaylggialhvwtikgyf
etidssleeaaaldgatpwqafrlvllplsvpilavvfilsfiaaitevpvaslllrdvn
sytlavgmqqylnpqnylwgdfaaaavmsalpitivfllaqr

Timeline for d3puzg_:

• d3puzg_ is new in SCOPe 2.01-stable
  
• d3puzg_ appears in SCOPe 2.02
  
• d3puzg_ appears in the current release, SCOPe 2.08