Lineage for d3puoa_ (3puo A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2443025Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2443158Protein Dihydrodipicolinate synthase [51574] (13 species)
  7. 2443261Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [189575] (2 PDB entries)
  8. 2443262Domain d3puoa_: 3puo A: [183980]
    automated match to d1dhpa_
    complexed with gol, lys

Details for d3puoa_

PDB Entry: 3puo (more details), 2.65 Å

PDB Description: Crystal structure of dihydrodipicolinate synthase from Pseudomonas aeruginosa(PsDHDPS)complexed with L-lysine at 2.65A resolution
PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3puoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3puoa_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
miagsmvalvtpfdaqgrldwdslaklvdfhlqdgtnaivavgttgesatldveehiqvv
rrvvdqvkgripviagtganstreavalteaaksggadacllvtpyynkptqegmyqhfr
hiaeavaipqilynvpgrtscdmlpetverlskvpniigikeatgdlqrakeviervgkd
flvysgddatavelmllggkgnisvtanvapramsdlcaaamrgdaaaaraindrlmplh
kalfiesnpipvkwalhemglipegirlpltwlsphchdplrqamrqtgvla

SCOPe Domain Coordinates for d3puoa_:

Click to download the PDB-style file with coordinates for d3puoa_.
(The format of our PDB-style files is described here.)

Timeline for d3puoa_: