SCOPe 2.06: Domain d3ppva1: 3ppv A:1493-1674

Lineage for d3ppva1 (3ppv A:1493-1674)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.0: automated matches [191586] (1 protein)
   not a true family

6. Protein automated matches [191045] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188880] (10 PDB entries)

8. Domain d3ppva1: 3ppv A:1493-1674 [183923]
   Other proteins in same PDB: d3ppva2
   automated match to d1fnsa_
   complexed with ca, so4

Details for d3ppva1

PDB Entry: 3ppv, 1.9 Å

PDB Description: crystal structure of an engineered vwf a2 domain (n1493c and c1670s)

PDB Compounds: (A:) von willebrand factor

SCOPe Domain Sequences for d3ppva1:

Sequence; same for both SEQRES and ATOM records:

>d3ppva1 c.62.1.0 (A:1493-1674) automated matches {Human (Homo sapiens) [TaxId: 9606]}
csmvldvafvlegsdkigeadfnrskefmeeviqrmdvgqdsihvtvlqysymvtveypf
seaqskgdilqrvreiryqggnrtntglalrylsdhsflvsqgdreqapnlvymvtgnpa
sdeikrlpgdiqvvpigvgpnanvqelerigwpnapiliqdfetlpreapdlvlqrcssg
eg

Timeline for d3ppva1:

• d3ppva1 first appeared in SCOPe 2.01, called d3ppva_
  
• d3ppva1 was called d3ppva_ in SCOPe 2.05
  
• d3ppva1 appears in SCOPe 2.07
  
• d3ppva1 appears in the current release, SCOPe 2.08