Lineage for d3potf_ (3pot F:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1417867Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 1417868Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (1 protein)
    automatically mapped to Pfam PF02240
  6. 1417869Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species)
  7. 1417870Species Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (12 PDB entries)
  8. 1417874Domain d3potf_: 3pot F: [183914]
    Other proteins in same PDB: d3pota1, d3pota2, d3potb1, d3potb2, d3potd1, d3potd2, d3pote1, d3pote2
    automated match to d1hbmc_
    complexed with 06c, com, edo, f43, k, mg, tp7, txz

Details for d3potf_

PDB Entry: 3pot (more details), 1.2 Å

PDB Description: structural analysis of a ni(iii)-methyl species in methyl-coenzyme m reductase from methanothermobacter marburgensis
PDB Compounds: (F:) Methyl-coenzyme M reductase I subunit gamma

SCOPe Domain Sequences for d3potf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3potf_ d.58.31.1 (F:) Methyl-coenzyme M reductase gamma chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfn

SCOPe Domain Coordinates for d3potf_:

Click to download the PDB-style file with coordinates for d3potf_.
(The format of our PDB-style files is described here.)

Timeline for d3potf_: