SCOPe 2.03: Domain d3pote1: 3pot E:2-188

Lineage for d3pote1 (3pot E:2-188)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families)
   each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures

5. Family d.58.31.0: automated matches [227271] (1 protein)
   not a true family

6. Protein automated matches [227074] (2 species)
   not a true protein

7. Species Methanothermobacter marburgensis [TaxId:145263] [226795] (1 PDB entry)

8. Domain d3pote1: 3pot E:2-188 [200222]
   Other proteins in same PDB: d3pota2, d3potb2, d3potc_, d3potd2, d3pote2, d3potf_
   automated match to d1e6vb2
   complexed with 06c, com, edo, f43, k, mg, tp7, txz

Details for d3pote1

PDB Entry: 3pot, 1.2 Å

PDB Description: structural analysis of a ni(iii)-methyl species in methyl-coenzyme m reductase from methanothermobacter marburgensis

PDB Compounds: (E:) Methyl-coenzyme M reductase I subunit beta

SCOPe Domain Sequences for d3pote1:

Sequence; same for both SEQRES and ATOM records:

>d3pote1 d.58.31.0 (E:2-188) automated matches {Methanothermobacter marburgensis [TaxId: 145263]}
akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak
vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf
dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi
pqklegp

Timeline for d3pote1:

• d3pote1 is new in SCOPe 2.03-stable
  
• d3pote1 appears in SCOPe 2.04
  
• d3pote1 appears in the current release, SCOPe 2.08